PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.4G265300.5.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB_related
Protein Properties Length: 302aa    MW: 34896.4 Da    PI: 7.1713
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.4G265300.5.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.18.1e-08197240146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         r +W++ + +l++++ +q+G++ ++ I + ++  +t+ q++ ++ +
  Seita.4G265300.5.p 197 RAKWSKSDTDLFYQGLQQFGSD-FAMIQQLLP-AKTRHQVRAKFKN 240
                         569*******************.*********.9*******99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.76E-10188245IPR009057Homeodomain-like
PfamPF159631.5E-24190272No hitNo description
PROSITE profilePS5129310.277195246IPR017884SANT domain
SMARTSM007171.0E-6196244IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-5197240IPR009057Homeodomain-like
CDDcd001676.89E-5199240No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MKLRCREKLQ KVGTPKHTGV DCFDEACVEH SLVEEDNDSG EDYIAGVKKK FTKKPRAGVE  60
EPQQQEVQKD KSQVSSGGWN TTLKDALVQK PEKKLTHRIH QKRMKEVKTL LETPREEIDP  120
MKLSAAHLRL LQEAREHVNA KELPSVPSSN TRFQLEDMDD LDCIHEEARN FDNDKTENHI  180
QNVTKLNYNS YMNIQTRAKW SKSDTDLFYQ GLQQFGSDFA MIQQLLPAKT RHQVRAKFKN  240
EEKKNPLQVH DAIIHRSGDY LYFKKVIEQL NIEDELPEIN STHREEGCTG WFHQRGGCTL  300
V*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004966291.10.0PREDICTED: transcription factor TFIIIB component B''-like isoform X3
TrEMBLA0A0D9UXP41e-107A0A0D9UXP4_9ORYZ; Uncharacterized protein
STRINGOB0157G10010.11e-106(Oryza brachyantha)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39160.14e-32MYB_related family protein